Molecular Weight: 4409.01 Da | 38 Amino Acids | Form: Lyophilized | Purity: 99%+ HPLC
Cagrilintide is a 38-amino-acid long-acting synthetic analogue of amylin, a peptide hormone co-secreted with insulin from the pancreas. Unlike natural amylin, Cagrilintide is engineered to resist enzymatic breakdown for an extended half-life, making it a key tool in amylinreceptor, satiety-signaling, gastric-emptying, and glucagon-suppression research. It is also studied in combination with GLP-1 analogues for synergistic metabolic pathway research. Each vial contains 10mg of lyophilized Cagrilintide at 99%+ HPLC-verified purity, with a batch-specific Certificate of Analysis available for download. *
Cagrilintide
Long-acting amylin analogue
Mechanism of Action• Amylin-Receptor Binding: binds amylin receptors (CALCR + RAMPs) with extended occupancy due to engineered enzymatic resistance.
• Satiety & Gastric-Emptying Modulation: studied for transmitting satiety signals from gut to brain and modulating gastric-emptying rate and nutrient absorption.
• Glucagon Suppression & Glucose Homeostasis: researched for suppressing glucagon secretion and supporting insulin-sensitivity and glucose-regulation pathway studies.
Together these make Cagrilintide a key tool in amylin-pathway, satiety, gastric, and metabolic research.
| Compound | Cagrilintide (long-acting amylin analogue) |
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (38 aa; X = acylated Lys) |
| Amino Acids | 38 |
| Formula | C₁₉₄H₃₁₂N₅₄O₅₉S₂ |
| MW | 4409.01 g/mol |
| CAS Number | 1415456-99-3 |
| Synonym | Cagri · Amylin analogue · PubChem 171397054 |
| Purity | ≥ 99% by HPLC |
| Identity | Confirmed by LC-MS |
| Form | Lyophilized powder |
| Vial Size / Sizes | 3mL glass vial · 5mg / 10mg (separate SKUs) |
| Fillers / Additives | None |
| Batch COA | Available for download |
Cagrilintide is studied across multiple preclinical research areas:
- Amylin-receptor binding & satiety-signaling pathway research
- Gastric-emptying modulation & nutrient-absorption studies
- Glucagon suppression & glucose-homeostasis research
- Insulin-sensitivity & metabolic physiology models
- Combination metabolic research (e.g. amylin + GLP-1 analogue studies)
- Amyloid-plaque clearance & neurological pathway research (speculative)
For research teams investigating amylin pathways, satiety biology, and metabolic regulation.
Storage & HandlingStorage: store lyophilized powder at -20°C long term; once reconstituted, store at 4°C, protect from light and moisture.
Handling: research use only; handle by licensed, qualified professionals with PPE. Reconstitution chemistry is the sole responsibility of the receiving research institution.
FEATURED INGREDIENTS
All Ingredients
Long-Acting Amylin Analogue
A 38-amino-acid synthetic amylin analogue engineered to resist enzymatic breakdown — enabling extended receptor occupancy in amylin-pathway research.
Satiety & Gastric Research
Studied for transmitting fullness signals from the gut to the brain and modulating gastric-emptying rate in metabolic models.
Metabolic Pathway Research
Researched for glucagon suppression and glucose-homeostasis pathway studies — studied alongside GLP-1 analogues.
PRODUCT BENEFITS
-
Long-Acting Amylin Analogue A 38-amino-acid synthetic amylin analogue engineered to resist enzymatic breakdown — enabling extended receptor occupancy in amylin-pathway and metabolic research.
-
Satiety & Brain-Gut Signaling Studied for transmitting fullness signals from the gut to the brain via amylin receptors, relevant to appetite and energy-intake research.
-
Gastric-Emptying Research Studied for modulating gastric-emptying rate and nutrient absorption in metabolic physiology models.
-
Glucagon Suppression Researched for suppressing glucagon secretion and supporting glucose-homeostasis pathway studies.
-
Combination Research Studied alongside GLP-1 analogues (e.g. Semaglutide) in dual-agonist metabolic pathway research.
-
99%+ HPLC-Verified Purity Independently verified by third-party labs via HPLC and LC-MS; batch-specific COA and SDS available pre-purchase.
CUSTOMERS ALSO PURCHASED
GLP1-T · 15mg Tirzepatide · Dual Receptor Agonist (GLP-1 + GIP) · Metabolic Research
GLP1-S · 5mg Semaglutide · GLP-1 Receptor Agonist · Metabolic Research
MOTS-c 10mg Mitochondria-Derived Peptide
Cagrilintide · 10mg Long-Acting Amylin Analogue · Metabolic & Satiety Research
Loved by thousands
Bundle and save 20%
5-Amino-1MQ · 5mg NNMT Inhibitor · Small Molecule (Quinolinium) · Metabolic & NAD+ Research
- Daily Vitamin
- Probiotics
Cagrilintide is a 38-amino-acid long-acting amylin analogue, engineered for extended receptor occupancy vs natural amylin. It is studied for binding amylin receptors (CALCR + RAMPs) to transmit satiety signals, modulate gastric-emptying rate, suppress glucagon secretion, and support glucosehomeostasis research — and is frequently studied alongside GLP-1 analogues for dual-pathway metabolic research.*
WHAT TO EXPECT
Independently verified by third-party labs
Batch number printed on every vial
Orders before 2 PM EST ship same business day
Plain FedEx/UPS, return label: Shipping Manager
Real human responses within hours
Independently verified by third-party labs
Batch number printed on every vial
Orders before 2 PM EST ship same business day
Plain FedEx/UPS, return label: Shipping Manager
Real human responses within hours
Amylin-Receptor Binding (CALCR + RAMPs)
Binds amylin receptors (calcitonin receptor + receptor activity-modifying proteins) with extended occupancy due to engineered enzymatic resistance — a key advantage for prolonged amylinpathway research vs natural amylin.
Satiety Signaling & Gastric-Emptying Modulation
Studied for transmitting gut-to-brain satiety signals and modulating gastric-emptying rate and nutrient absorption in metabolic physiology models.
Glucagon Suppression & Glucose Homeostasis
Researched for suppressing glucagon secretion and supporting insulin-sensitivity and glucoseregulation pathway studies, including combination research with GLP-1 analogues.
ALL DETAILS
- Amylin-Receptor Binding (CALCR + RAMPs) — Binds amylin receptors (calcitonin receptor + receptor activity-modifying proteins) with extended occupancy due to engineered enzymatic resistance — a key advantage for prolonged amylinpathway research vs natural amylin.
- Satiety Signaling & Gastric-Emptying Modulation — Studied for transmitting gut-to-brain satiety signals and modulating gastric-emptying rate and nutrient absorption in metabolic physiology models.
- Glucagon Suppression & Glucose Homeostasis — Researched for suppressing glucagon secretion and supporting insulin-sensitivity and glucoseregulation pathway studies, including combination research with GLP-1 analogues.
The "Cagrilintide" Peptide |
No fillers | No artificial additives | No excipients | 99%+ HPLC verified · batch COA | No repackaged imports | No human-use claims |
|---|---|---|---|---|---|---|
|
Cagrilintide Peptide
|
||||||
Other Peptide |
The "Cagrilintide" Peptide
| Compare to: | Cagrilintide Peptide |
Other Peptide |
|---|---|---|
| No fillers | ||
| No artificial additives | ||
| No excipients | ||
| 99%+ HPLC verified · batch COA | ||
| No repackaged imports | ||
| No human-use claims |
FAQs
GHK-Cu (Glycyl-L-Histidyl-L-Lysine Copper Complex) is a naturally occurring copper-binding tripeptide studied extensively in preclinical and in vitro research models. It is primarily researched for its role in tissue repair, collagen synthesis, wound healing, gene expression modulation, hair follicle biology, and antioxidant defense pathways.
Lyophilized means the compound has been freeze-dried — water is removed under vacuum to produce a stable powder. This process significantly extends shelf life and preserves compound integrity during storage and shipping. Lyophilized peptides are the research-grade standard because they maintain purity far longer than liquid formulations.
Each batch of GHK-Cu is independently verified at ≥99% purity using HPLC (High-Performance Liquid Chromatography). Identity is further confirmed by LC-MS (Liquid Chromatography-Mass Spectrometry). A batch-specific Certificate of Analysis (COA) is available for download before purchase.
Store lyophilized GHK-Cu at −20°C upon receipt. Keep protected from light, heat, and moisture. Do not open the vial until needed for your research protocol. Under proper storage conditions, lyophilized GHK-Cu maintains compound integrity for up to 24 months.
No. Peptides Verse does not provide reconstitution, dosing, or administration guidance of any kind. All reconstitution protocols are the sole responsibility of the qualified researcher or institution receiving this compound. This product is strictly for in vitro and laboratory research use only.
Yes. A batch-specific COA is available for every vial of GHK-Cu sold by Peptides Verse. The COA includes HPLC purity data, LC-MS identity confirmation, lot number, and testing lab details. It can be downloaded directly from the product page before or after purchase.
GHK refers to the free tripeptide (Glycyl-L-Histidyl-L-Lysine) without copper. GHK-Cu is the copper-chelated form — where a Cu² ion is bound to the tripeptide. The copper-chelated form is the biologically active version studied in most published research on wound healing, collagen synthesis, and gene expression modulation.
No. GHK-Cu from Peptides Verse is strictly for in vitro research and laboratory experimentation only. It is not intended for human or animal use of any kind. By purchasing, the buyer confirms they are a qualified researcher or institution and accepts full responsibility for safe handling and use.
All orders are shipped via FedEx with temperature-appropriate packaging to protect compound integrity during transit. Packaging is discreet — plain FedEx or UPS with no product branding on the exterior. Orders placed before 2 PM EST ship same business day.
Due to the nature of research chemicals, all sales are final once a vial has been opened or the seal broken. If you receive a damaged or incorrect item, contact support@peptidesverse.com within 48 hours of delivery with your order number and photos.