{"product_id":"cagrilintide-10mg","title":"Cagrilintide 10mg","description":"\u003cp\u003eOVERVIEW\u003cbr\u003e\nCagrilintide is a long-acting analogue of amylin, a peptide hormone that is naturally secreted alongside insulin. It has shown promise in obesity and type 2 diabetes treatment, with ongoing research exploring its potential applications in liver disease, alcohol-related liver conditions, and cardiovascular health.\u003cbr\u003e\nWhile there is speculation about its role in Alzheimer’s disease, no published studies have yet confirmed its effects in this area. Many trials have examined the combination of Cagrilintide and Semaglutide, suggesting that their combined use leads to enhanced and more sustainable weight loss results compared to either peptide alone.\u003cbr\u003e\nAlthough early research highlights its potential therapeutic benefits, human clinical trials remain limited, necessitating further investigation to confirm its safety and efficacy.\u003cbr\u003e\nRESEARCH\u003cbr\u003e\nCagrilintide and Amylin\u003cbr\u003e\nCagrilintide is a synthetic version of amylin, a hormone co-released with insulin from the pancreas. Amylin plays a crucial role in:\u003c\/p\u003e\n\n\u003cp\u003eRegulating blood sugar levels\u003cbr\u003e\nSlowing gastric emptying\u003cbr\u003e\nSignaling satiety (fullness) to the brain\u003c\/p\u003e\n\n\u003cp\u003eUnlike natural amylin, Cagrilintide is engineered to resist enzymatic breakdown, resulting in a longer half-life and extended duration of action.\u003cbr\u003e\nCagrilintide for Weight Management\u003cbr\u003e\nCagrilintide has been evaluated in clinical trials for its potential to support weight loss. In a notable study, individuals receiving Cagrilintide experienced a 6-11% reduction in body weight within just six weeks.\u003cbr\u003e\nWhen Cagrilintide is combined with Semaglutide, research suggests their weight loss benefits are synergistic rather than merely additive, leading to reductions in body weight of up to 17.1% within 20 weeks.\u003cbr\u003e\nCagrilintide and Diabetes Management\u003cbr\u003e\nCagrilintide supports diabetes treatment through several mechanisms:\u003c\/p\u003e\n\n\u003cp\u003eEnhancing insulin sensitivity\u003cbr\u003e\nReducing hemoglobin A1C (HbA1c) levels\u003cbr\u003e\nSuppressing glucagon secretion\u003c\/p\u003e\n\n\u003cp\u003eOne clinical study demonstrated a 2.2% decrease in HbA1c levels over a short treatment period, with the extended half-life of Cagrilintide allowing for more stable glucose regulation over time.\u003cbr\u003e\nCagrilintide and Alzheimer’s Disease\u003cbr\u003e\nResearch has linked amylin to amyloid-beta plaque accumulation, a hallmark of Alzheimer’s disease. High levels of natural amylin can form toxic fibrils that may contribute to cognitive decline.\u003cbr\u003e\nSome studies suggest that synthetic amylin analogues could aid in clearing amyloid plaques from the brain, but no direct research on Cagrilintide’s role in Alzheimer’s disease has been conducted yet.\u003cbr\u003e\nSTRUCTURE\u003c\/p\u003e\n\n\u003cp\u003eMolecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂\u003cbr\u003e\nMolecular Weight: 4409.01 g\/mol\u003cbr\u003e\nCAS Registry Number: 1415456-99-3\u003cbr\u003e\nAmino Acid Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP\u003cbr\u003e\nPubChem Identifier: 171397054\u003c\/p\u003e\n\n\u003cp\u003eCITATIONS\u003c\/p\u003e\n\n\u003cp\u003ePittner, R. A. et al. Molecular physiology of amylin. Journal of Cellular Biochemistry (1994).\u003cbr\u003e\nShen, Y. et al. Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.Nature (2006).\u003cbr\u003e\nLutz, T. A. Creating the amylin story. Appetite (2022).\u003cbr\u003e\nKruse, T. et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry (2021).\u003cbr\u003e\nHay, D. L., \u0026amp; Pioszak, A. A. Receptor Activity-Modifying Proteins (RAMPs): New Insights and Roles. Annual Review of Pharmacology and Toxicology (2016).\u003cbr\u003e\nDehestani, B. et al. Amylin as a Future Obesity Treatment. Journal of Obesity \u0026amp; Metabolic Syndrome (2021).\u003cbr\u003e\nLau, D. C. W. et al. Once-weekly Cagrilintide for weight management: a multicenter, randomized, placebo-controlled trial. Lancet (2021).\u003cbr\u003e\nEnebo, L. B. et al. Safety, tolerability, and pharmacokinetics of Cagrilintide with Semaglutide. Lancet (2021).\u003cbr\u003e\nFrias, J. P. et al. Efficacy of co-administered Cagrilintide and Semaglutide in type 2 diabetes. The Lancet (2023).\u003cbr\u003e\nBailey, C. J. et al. Peptide-based therapies for obesity and type 2 diabetes. Peptides (2024).\u003cbr\u003e\nWarren, R. E. et al. Hypoglycemia and cognitive function. Diabetes Obesity and Metabolism (2005).\u003cbr\u003e\nZhang, S. et al. Cognitive dysfunction in diabetes: abnormal glucose metabolism in the brain. Frontiers in Endocrinology (2023).\u003cbr\u003e\nYang, Y. et al. Expert Consensus on Cognitive Dysfunction in Diabetes. Current Medical Science (2022).\u003cbr\u003e\nZhu, H. et al. Association of Plasma Amylin Concentration With Alzheimer Disease. JAMA Network Open (2019).\u003cbr\u003e\nQiu, W. et al. Association between amylin and amyloid-β peptides in plasma. PLoS One (2014).\u003c\/p\u003e","brand":"Biogenesis Peptides","offers":[{"title":"Default Title","offer_id":50989561807081,"sku":"PS011","price":72.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0808\/6559\/1529\/files\/CAGRILINTIDE-10MG-scaled.jpg?v=1778509503","url":"https:\/\/peptidesverse.com\/products\/cagrilintide-10mg","provider":"Peptides Verse","version":"1.0","type":"link"}